PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G24260.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 397aa    MW: 45049 Da    PI: 5.7364
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G24260.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-11103141240
                      XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLea 40 
                      +++k+ rr+++NReAAr+sR+RKka+i++Le+   +L +
  OPUNC04G24260.2 103 PPDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQ 141
                      5799***************************84443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-899151No hitNo description
SMARTSM003383.4E-11102166IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.933104148IPR004827Basic-leucine zipper domain
PfamPF001702.5E-8104144IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.63E-7106150No hitNo description
CDDcd147082.11E-21106155No hitNo description
PROSITE patternPS000360109124IPR004827Basic-leucine zipper domain
PfamPF141444.0E-26194270IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MELYPGYLED HFNIHKLSIS SASPPEFMTS ASTQFAAPIR MGAYDRPPPV GMWSHEQFKV  60
DNGQATSAST IMEADMKFET RLEEIPQVVL EEGRNVDQEA SKPPDKVLRR LAQNREAARK  120
SRLRKKAYIQ QLETSRLKLA QLEQELQRAR QQGVYANGSL REPNLGFTGP IDPGALGFEI  180
KYSHWVDEQN RNTGELRNAL LQGQTTDQDL ELKLLVEAGL DNYNRLFEMK EEAANSDVFY  240
IMSGMWKTPT ERFFLWIGGF RPSEVLKNLR PQLEPLTDKQ VVEVGGLQQT SMQVEDALSQ  300
GMDKLKQTIA DSLTAADPFD SPEAYMVHMA NAVEQLRSLV QFVTQADHLR QQTLQEMHRI  360
LTTRQAARGL LALGDYFQRF RALSSLWAAR PRDSGIS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0737150.0AK073715.1 Oryza sativa Japonica Group cDNA clone:J033059P06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636710.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636711.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636712.10.0PREDICTED: transcription factor TGA4 isoform X1
RefseqXP_015636713.10.0PREDICTED: transcription factor TGA4 isoform X2
RefseqXP_015636714.10.0PREDICTED: transcription factor TGA4 isoform X2
RefseqXP_015636715.10.0PREDICTED: transcription factor TGA4 isoform X2
SwissprotQ391621e-132TGA4_ARATH; Transcription factor TGA4
TrEMBLA0A0E0KVS10.0A0A0E0KVS1_ORYPU; Uncharacterized protein
STRINGLOC_Os04g54474.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-123TGACG motif-binding factor 4